QKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACL
The query sequence (length=85) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
1mnm:A |
85 |
85 |
1.0000 |
1.0000 |
1.0000 |
4.43e-59 |
1mnm:B |
2 |
1hbx:E |
89 |
81 |
0.6471 |
0.6180 |
0.6790 |
1.12e-36 |
1hbx:A, 1hbx:B, 1hbx:D, 1k6o:B, 1k6o:C, 1srs:A, 1srs:B |
3 |
8c84:B |
93 |
64 |
0.2706 |
0.2473 |
0.3594 |
1.05e-11 |
6byy:D, 6bz1:D, 1c7u:A, 1c7u:B, 8c84:A, 1egw:A, 1egw:B, 1egw:C, 1egw:D, 3kov:B, 3kov:A, 3kov:I, 3kov:J, 3mu6:A, 3mu6:B, 3mu6:D, 3mu6:C, 3p57:A, 3p57:B, 3p57:C, 3p57:D, 3p57:I, 3p57:J, 8pde:D, 8pde:E, 8pde:A, 8pde:B, 8q9n:A, 8q9n:B, 8q9p:B, 8q9p:A, 8q9q:A, 8q9q:B, 8q9r:A, 8q9r:B, 8q9r:E, 8q9r:F, 6wc2:C, 7x1n:A, 7x1n:D, 7x1n:B, 7x1n:C, 7xuz:D, 7xuz:C, 7xuz:H, 7xuz:G |
4 |
1n6j:A |
93 |
64 |
0.2706 |
0.2473 |
0.3594 |
5.21e-11 |
6byy:A, 6byy:B, 6byy:C, 6bz1:C, 6bz1:A, 6bz1:B, 1n6j:B, 1tqe:P, 1tqe:Q, 1tqe:R, 1tqe:S, 6wc2:I, 6wc2:J, 6wc2:D, 6wc2:A, 6wc2:B, 6wc5:A, 6wc5:B, 6wc5:C, 6wc5:D |
5 |
8ci0:AAA |
666 |
22 |
0.1294 |
0.0165 |
0.5000 |
4.7 |
8ci0:BBB, 8ci0:CCC, 1itz:A, 1itz:B, 1itz:C |
6 |
6lfl:A |
471 |
30 |
0.1294 |
0.0234 |
0.3667 |
6.6 |
|
7 |
7usf:A |
265 |
23 |
0.0824 |
0.0264 |
0.3043 |
8.2 |
5cz2:A, 5cz2:B, 5cz2:C, 5cz2:D, 5cz2:E, 5cz2:G, 5cz2:H, 5cz2:I, 5cz2:J, 5cz2:K, 5cz2:L, 3jca:A, 3jca:D, 3jca:E, 3jca:G, 3jca:C, 3jca:H, 3jca:B, 3jca:F, 7usf:B, 7ut1:a, 7ut1:d, 7ut1:e, 7ut1:A, 7ut1:D, 7ut1:E, 7ut1:C |