NEWTLELLEELKSEAVRHFPRIWLHNLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCSH
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6xqj:A | 173 | 63 | 0.9841 | 0.3584 | 0.9841 | 5.06e-42 | 6xqi:C, 6xqi:B, 6xqi:A, 6xqi:D |
2 | 6zx9:C | 257 | 62 | 0.3492 | 0.0856 | 0.3548 | 0.010 | |
3 | 4mlp:C | 492 | 55 | 0.2381 | 0.0305 | 0.2727 | 0.039 | 7ej9:A, 7ej9:B, 4i6g:A, 4i6g:B, 6kx8:A, 6kx8:B, 4mlp:A, 4mlp:B, 4mlp:D, 4u8h:A, 4u8h:C, 7v8y:A, 7v8z:A |
4 | 4cc9:B | 98 | 65 | 0.2381 | 0.1531 | 0.2308 | 0.19 | |
5 | 3cvv:A | 519 | 35 | 0.2063 | 0.0250 | 0.3714 | 0.32 | 7ayv:A, 7azt:A, 8c1u:A, 8c69:A, 8c6a:A, 8c6b:A, 8c6c:A, 8c6f:A, 8c6h:A, 3cvu:A, 3cvw:A, 3cvx:A, 3cvy:A, 7qut:A, 2wb2:A, 2wq6:A, 2wq7:A |
6 | 7dqx:D | 770 | 40 | 0.2381 | 0.0195 | 0.3750 | 2.9 | 7dqx:A |
7 | 6z9l:A | 744 | 56 | 0.2698 | 0.0228 | 0.3036 | 3.8 | 6z9k:A, 6z9k:B |
8 | 8zyo:A | 210 | 14 | 0.1429 | 0.0429 | 0.6429 | 4.8 | 8zyo:B, 8zyo:D, 8zyp:A, 8zyp:C, 8zyp:D, 8zyq:B, 8zyq:C, 8zyq:D |
9 | 2x3l:B | 423 | 46 | 0.2222 | 0.0331 | 0.3043 | 4.9 | 2x3l:A |
10 | 8zyq:A | 166 | 14 | 0.1429 | 0.0542 | 0.6429 | 5.6 | |
11 | 3be7:A | 398 | 58 | 0.2540 | 0.0402 | 0.2759 | 8.0 | 3be7:E, 3be7:B, 3be7:D, 3be7:C, 3be7:F, 3be7:G, 3be7:H, 3dug:A, 3dug:B, 3dug:C, 3dug:D, 3dug:E, 3dug:F, 3dug:G, 3dug:H |