>protein
MYEGNNMRSMMGTSYEDSRLNKRTELNENMSIDTNKSEDSYGVQIHSLSKQSFTG
The query sequence (length=55) is searched through a non-redundant set of database sequences
protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6iat:F |
55 |
55 |
1.0000 |
1.0000 |
1.0000 |
3.82e-35 |
6iaw:S, 6iaw:I, 6iaw:Q, 6iaw:D, 6ib1:F, 6q3g:F1, 6q3g:N1, 6q3g:U1, 6q3g:c1, 6q3g:k1, 6q3g:F3, 6q3g:N3, 6q3g:V3, 6q3g:EK, 6q3g:ED, 6q3g:F4, 6q3g:N4, 6q3g:U4, 6q3g:c4, 6q3g:j4, 6q3g:F6, 6q3g:N6, 6q3g:V6, 6q3g:d6, 6q3g:l6, 6q3g:F7, 6q3g:N7, 6q3g:V7, 6q3g:d7, 6q3g:l7, 6q3g:F8, 6q3g:N8, 6q3g:V8, 6q3g:d8, 6q3g:l8, 6q3g:ND, 6q3g:FD, 6q3g:MD, 6q3g:GD, 6q3g:EP, 6q3g:HE, 6q3g:PE, 6q3g:XE, 6q3g:fE, 6q3g:FG, 6q3g:NG, 6q3g:VG, 6q3g:dG, 6q3g:lG, 6q3g:NJ, 6q3g:FJ, 6q3g:MJ, 6q3g:GJ, 6q3g:NK, 6q3g:FK, 6q3g:MK, 6q3g:GK, 6q3g:FL, 6q3g:NL, 6q3g:VL, 6q3g:dL, 6q3g:EJ, 6q3g:MP, 6q3g:NP, 6q3g:FP, 6q3g:GP, 6q3g:FQ, 6q3g:NQ, 6q3g:VQ, 6q3g:DS, 6q3g:gQ, 6q3g:FR, 6q3g:NR, 6q3g:VR, 6q3g:dR, 6q3g:kR, 6q3g:MS, 6q3g:ES, 6q3g:LS, 6q3g:FS |
2 |
7pkt:j |
120 |
27 |
0.1636 |
0.0750 |
0.3333 |
3.0 |
|
3 |
2uxq:A |
402 |
35 |
0.1818 |
0.0249 |
0.2857 |
5.7 |
4aov:A, 2uxr:B |
4 |
1vlj:B |
400 |
25 |
0.1818 |
0.0250 |
0.4000 |
6.6 |
1vlj:A |
5 |
1i7q:A |
517 |
23 |
0.1455 |
0.0155 |
0.3478 |
9.0 |
1i7q:C, 1i7s:A, 1i7s:C |
6 |
6kme:A |
284 |
22 |
0.1818 |
0.0352 |
0.4545 |
9.0 |
6kmd:A |
[Back]