MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGREFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISP
VEQVIRIRTGEKN
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8wm7:G | 94 | 94 | 1.0000 | 0.9894 | 0.9894 | 9.81e-59 | |
2 | 3n5b:A | 112 | 108 | 1.0000 | 0.8304 | 0.8611 | 9.76e-57 | 8wm7:E |
3 | 4c3k:D | 101 | 94 | 0.9032 | 0.8317 | 0.8936 | 1.31e-54 | 4c3k:A, 4c3k:E, 8wm7:F, 2xzw:E |
4 | 2xbp:A | 113 | 108 | 0.8925 | 0.7345 | 0.7685 | 1.98e-51 | 4aff:A, 4c3k:C, 4c3k:F, 2xul:A, 2xul:B, 2xul:C, 2xul:D, 2xul:E, 2xul:F, 2xzw:A, 2xzw:B, 2xzw:C, 2xzw:D, 2xzw:F, 2xzw:G, 2xzw:H, 2xzw:I |
5 | 1ul3:B | 94 | 93 | 0.8495 | 0.8404 | 0.8495 | 2.31e-50 | 1ul3:C |
6 | 3lf0:A | 99 | 93 | 0.5591 | 0.5253 | 0.5591 | 6.80e-38 | |
7 | 2eg2:A | 95 | 93 | 0.6559 | 0.6421 | 0.6559 | 7.60e-35 | |
8 | 3lf0:B | 112 | 107 | 0.5591 | 0.4643 | 0.4860 | 6.89e-34 | 3lf0:C |
9 | 5l9n:A | 92 | 93 | 0.6237 | 0.6304 | 0.6237 | 1.71e-33 | |
10 | 4cnz:A | 100 | 96 | 0.6237 | 0.5800 | 0.6042 | 4.39e-33 | 4cny:A, 4cnz:B, 4cnz:D, 4co4:A, 4co4:C, 4co4:B, 3o5t:B, 5ovo:B |
11 | 4cnz:E | 112 | 108 | 0.6237 | 0.5179 | 0.5370 | 2.89e-31 | 4cnz:C, 4cnz:F, 4co0:A, 4co0:B, 4co1:A, 4co1:B, 4co2:A, 4co2:B, 4co3:A, 4co3:B, 3mhy:A, 3mhy:C, 3mhy:B |
12 | 2o66:B | 108 | 91 | 0.5699 | 0.4907 | 0.5824 | 2.41e-30 | 2o66:A, 2o66:C, 2o67:A, 2o67:B, 2o67:C |
13 | 7p4v:A | 113 | 107 | 0.6237 | 0.5133 | 0.5421 | 2.29e-29 | |
14 | 2gnk:A | 95 | 93 | 0.5376 | 0.5263 | 0.5376 | 3.89e-29 | |
15 | 2j9d:B | 103 | 94 | 0.6022 | 0.5437 | 0.5957 | 8.61e-29 | 2j9d:H, 2j9d:K |
16 | 2rd5:D | 126 | 107 | 0.5806 | 0.4286 | 0.5047 | 9.95e-29 | 2rd5:C |
17 | 3ta0:C | 99 | 94 | 0.5699 | 0.5354 | 0.5638 | 1.23e-28 | 3ta0:A, 3ta0:B, 3ta0:D, 3ta0:E, 3ta0:F |
18 | 2ns1:B | 113 | 108 | 0.5484 | 0.4513 | 0.4722 | 3.41e-28 | 2nuu:G, 2nuu:H, 2nuu:I, 2nuu:J, 2nuu:K, 2nuu:L |
19 | 2j9e:B | 119 | 107 | 0.6237 | 0.4874 | 0.5421 | 1.99e-27 | 2j9c:A, 2j9c:C, 2j9c:B, 2j9d:C, 2j9d:E, 2j9d:F, 2j9d:I, 2j9d:J, 2j9d:L, 2j9e:A, 2j9e:C, 7p52:A |
20 | 7p50:A | 121 | 107 | 0.5914 | 0.4545 | 0.5140 | 1.00e-26 | 7p50:B, 7p50:C |
21 | 3ta1:D | 115 | 108 | 0.5699 | 0.4609 | 0.4907 | 2.61e-26 | 3ta1:A, 3ta1:C, 3ta1:B, 3ta1:E, 3ta1:F, 3ta2:A, 3ta2:B, 3ta2:C |
22 | 6yc7:F | 94 | 92 | 0.4409 | 0.4362 | 0.4457 | 2.78e-26 | |
23 | 6yc7:A | 105 | 100 | 0.4409 | 0.3905 | 0.4100 | 2.29e-25 | 6yc7:B, 6yc7:E, 6yc7:C |
24 | 1v3s:A | 97 | 95 | 0.5269 | 0.5052 | 0.5158 | 2.45e-24 | 1v3s:B, 1v3s:C, 1v9o:A, 1v9o:B, 1v9o:C |
25 | 3ncr:C | 116 | 108 | 0.5591 | 0.4483 | 0.4815 | 5.11e-24 | 3ncq:A, 3ncq:B, 3ncq:C, 3ncr:A, 3ncr:B |
26 | 4ozl:A | 104 | 91 | 0.5269 | 0.4712 | 0.5385 | 1.63e-20 | 4ozn:B |
27 | 7o4x:A | 103 | 95 | 0.4516 | 0.4078 | 0.4421 | 2.59e-19 | |
28 | 4usj:C | 142 | 105 | 0.5054 | 0.3310 | 0.4476 | 1.37e-18 | 4usi:A, 4usi:C, 4usi:B, 4usj:D |
29 | 4ozn:A | 116 | 103 | 0.5269 | 0.4224 | 0.4757 | 7.43e-17 | 4ozj:A, 4ozn:C |
30 | 4rx6:B | 115 | 107 | 0.3978 | 0.3217 | 0.3458 | 1.10e-12 | 4r25:A, 4rx6:A, 4rx6:D |
31 | 3mcx:A | 459 | 67 | 0.1505 | 0.0305 | 0.2090 | 1.3 | |
32 | 3lvt:A | 833 | 48 | 0.1613 | 0.0180 | 0.3125 | 1.3 | |
33 | 8tyx:B | 162 | 76 | 0.1613 | 0.0926 | 0.1974 | 1.3 | 8tyy:B |
34 | 4yd9:A | 1656 | 54 | 0.1720 | 0.0097 | 0.2963 | 3.7 | 4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b |
35 | 7o9q:B | 308 | 12 | 0.0968 | 0.0292 | 0.7500 | 5.3 | 7o9q:A |
36 | 8wm6:k | 180 | 33 | 0.1398 | 0.0722 | 0.3939 | 7.0 | 8wmj:k, 8wmv:k, 8wmw:k |
37 | 5fmf:M | 116 | 44 | 0.1398 | 0.1121 | 0.2955 | 8.2 | 8cen:U, 8ceo:U, 7ml1:U, 7ml4:U, 1nh2:C, 7o4i:U, 7o4j:U, 7o72:U, 7o73:U, 7o75:U, 7oha:L, 5sva:d, 1ytf:C, 7zs9:U, 7zsa:U, 7zsb:U |
38 | 8rd8:C1 | 49 | 25 | 0.1290 | 0.2449 | 0.4800 | 9.2 | 8rdv:C1, 8rdw:C1 |
39 | 8w4g:A | 876 | 52 | 0.1505 | 0.0160 | 0.2692 | 9.5 | 8w4i:A, 8w4n:A, 8x8g:A |