GSMADTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRWNKDCTFNWLSSQRSKNSS
The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2alc:A | 65 | 65 | 1.0000 | 1.0000 | 1.0000 | 3.26e-42 | 3alc:A, 1f4s:P, 1f5e:P |
2 | 1cld:A | 33 | 43 | 0.2000 | 0.3939 | 0.3023 | 1.3 | |
3 | 6gys:B | 579 | 45 | 0.1692 | 0.0190 | 0.2444 | 1.3 | 6f07:B, 6gyp:B, 6gys:C, 6gys:J, 6gys:I, 6gyu:B, 7k7g:M, 8ow1:CE |
4 | 6qf7:B | 244 | 12 | 0.1077 | 0.0287 | 0.5833 | 4.8 | 6b74:B, 6b77:B, 6l63:A, 6l63:C, 6qf7:D, 8r8d:B, 8r8d:A, 6x0s:A, 6x0s:B, 6x0s:C, 6x0t:A, 6x0t:B, 6x0t:C |
5 | 6h5l:A | 506 | 21 | 0.1231 | 0.0158 | 0.3810 | 4.9 | |
6 | 8csz:D | 494 | 26 | 0.1385 | 0.0182 | 0.3462 | 6.8 | |
7 | 5j55:A | 480 | 35 | 0.1385 | 0.0187 | 0.2571 | 8.0 | 5j53:A, 5j54:A, 7qr6:A, 7qr6:B, 7qr6:C |
8 | 5jmd:A | 646 | 35 | 0.1846 | 0.0186 | 0.3429 | 8.2 | 5jmf:A |