Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP Library
>protein
GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPA

The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 5lum:A 78 78 1.0000 1.0000 1.0000 7.03e-51 5lum:B, 5lum:D, 5lum:C, 5lum:E
2 4m5s:A 87 73 0.6026 0.5402 0.6438 8.46e-33 4m5t:A, 4m5t:C, 4m5t:E, 4m5t:G
3 3l1e:A 105 73 0.5000 0.3714 0.5342 3.29e-27
4 6gjh:F 87 73 0.5128 0.4598 0.5479 2.39e-26 6gjh:D, 6gjh:H, 6gjh:B, 4mjh:A, 4mjh:C
5 6f2r:Q 89 74 0.3718 0.3258 0.3919 1.00e-17 6f2r:T, 6f2r:V
6 3gla:B 99 81 0.2949 0.2323 0.2840 0.12 3gla:A
7 7x2u:A 541 50 0.1923 0.0277 0.3000 2.3 7x2u:B
8 7qhm:A 402 18 0.1538 0.0299 0.6667 2.4 7q21:A, 7q21:a, 7qhm:N, 7qho:A, 7qho:N
9 6sxb:G 191 33 0.1410 0.0576 0.3333 2.9 2jnw:A
10 4v6w:CD 290 45 0.1795 0.0483 0.3111 3.2 6xu6:CD, 6xu7:CD, 6xu8:CD
11 1v9n:A 348 60 0.1795 0.0402 0.2333 4.6
12 2bis:A 440 46 0.2051 0.0364 0.3478 5.0 2bis:C, 3fro:B, 3l01:A, 3l01:B
13 3m85:I 259 56 0.2692 0.0811 0.3750 5.1 3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417