Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP Library
>protein
ANENILKLKLYRSLGVILDLENDQVLINRNDGNIDILPLDNNLSDFYKTKYIWERLGK

The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 5t6j:A 59 59 1.0000 0.9831 0.9831 1.09e-33 4geq:D, 4geq:B
2 7kdf:C 95 56 0.8793 0.5368 0.9107 5.22e-29
3 8ro2:C 908 43 0.2414 0.0154 0.3256 2.3 7aav:r, 7abf:r, 7abg:r, 7abi:r, 6ah0:C, 6ahd:C, 8c6j:C, 8ch6:b, 7dvq:C, 6ff4:B, 6ff7:B, 9fmd:C, 8h6e:5C, 8h6j:5C, 8h6k:5C, 8h6l:5C, 8i0p:C, 8i0r:C, 8i0s:C, 8i0t:C, 8i0u:C, 8i0v:C, 8i0w:C, 6icz:C, 6id0:C, 6id1:C, 8q7q:C, 8q7v:C, 8q7w:C, 8q7x:C, 8q91:C, 6qdv:C, 8qp8:C, 7qtt:b, 6qw6:5C, 6qx9:5C, 8rc0:C, 7w59:C, 7w5a:C, 7w5b:C, 5xjc:C, 8y6o:D, 5yzg:C, 5z56:C, 5z57:C, 5z58:C, 6zym:B
4 8wa0:L 235 34 0.2069 0.0511 0.3529 2.9 8w9z:L, 8wa1:L
5 8e2l:C 461 17 0.1724 0.0217 0.5882 3.2 8e2l:A, 8e2l:B, 8e2l:D, 8e2l:E, 8e2l:F
6 6ttd:A 457 29 0.1724 0.0219 0.3448 5.1 6syy:A, 6ttd:B
7 8ro0:C 898 39 0.2241 0.0145 0.3333 7.0 8ro1:C
8 8hxx:N 375 32 0.2241 0.0347 0.4062 9.0 8hxy:N, 8hy0:N, 8i3f:B, 8jho:N, 8tof:G, 8w9c:E, 8w9d:E, 8w9e:E, 8w9f:E

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417