BioLiP Library

>protein
AMKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIGFNAAEAASVTKNYGIKRFGAKS

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4lmx:C	66	66	1.0000	1.0000	1.0000	1.58e-42	8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F
2	4lmx:E	66	66	0.8939	0.8939	0.8939	4.59e-37	8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K
3	4lm6:A	62	58	0.5152	0.5484	0.5862	8.32e-18	4lm6:C
4	7s96:A	63	60	0.5606	0.5873	0.6167	1.74e-17	7s96:C, 7s97:C, 7t89:A, 7t89:C
5	7ssf:A	72	49	0.4091	0.3750	0.5510	3.46e-10	7ssf:C, 7ssf:E, 7ssf:G
6	7t7u:A	81	56	0.3485	0.2840	0.4107	2.53e-05
7	7t7u:C	70	59	0.3636	0.3429	0.4068	3.11e-05
8	7t8s:D	70	60	0.3788	0.3571	0.4167	1.76e-04	7t8s:H, 7t8s:L, 7t8s:P
9	4lms:A	80	50	0.3333	0.2750	0.4400	2.20e-04
10	7t8s:B	78	57	0.3485	0.2949	0.4035	8.16e-04	7t8s:F, 7t8s:J, 7t8s:N
11	7tja:G	67	61	0.3788	0.3731	0.4098	0.002	7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
12	1qgw:A	76	62	0.3030	0.2632	0.3226	0.010	1xf6:A, 1xg0:A
13	7tja:I	75	42	0.2576	0.2267	0.4048	0.058	7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
14	7sut:A	78	65	0.3788	0.3205	0.3846	0.064	7sut:E
15	1qgw:B	67	42	0.2879	0.2836	0.4524	0.21	1xf6:B, 1xg0:B
16	2lua:A	52	29	0.1061	0.1346	0.2414	8.7	4rkg:B, 4rkh:D, 4rkh:E, 4rkh:C, 4rkh:F
17	6kz8:A	784	39	0.1970	0.0166	0.3333	8.9	6kz8:B, 6kz9:A

[Back]