Structure of PDB 4wzj Chain NNNN |
>4wzjNNNN (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] |
KAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSG QQNNIGMVVIRGNSIIMLEALERV |
|
PDB | 4wzj Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis. |
Chain | NNNN |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
NNNN |
F37 N39 R63 N65 |
F35 N37 R61 N63 |
|
|
|
|