BioLiP

Structure of PDB 3p70 Chain H

Receptor sequence

>3p70H (length=254) Species: 9606 (Homo sapiens) [Search protein sequence]

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERIEKISMLEKIYIHPRYNWRENLDRDIA
LMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTAK
GQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGD
SGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI
DQFG

3D structure

PDB

3p70 Structural basis of thrombin-mediated factor V activation: the Glu666-Glu672 sequence is critical for processing at the heavy chain-B domain junction.

Chain

Resolution

2.55 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H406 D462 E565 G566 D567 S568 G569
Catalytic site (residue number reindexed from 1)	H43 D98 E198 G199 D200 S201 G202
Enzyme Commision number	3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	H	E371 I372 G373 M374 P376 W377 D476 H479 P480 V481 C482 Y497 K498 G499 R500 N527 M574 K575 R581 W582	E8 I9 G10 M11 P13 W14 D112 H115 P116 V117 C118 Y133 K134 G135 R136 N160 M207 K208 R214 W215
BS02	peptide	H	W413 T510 W511	W50 T146 W147
BS03	peptide	H	F382 L389 R431 T432 R433 Y434	F19 L26 R68 T69 R70 Y71
BS04	BEN	H	D562 A563 E565 V588 W590 G593 C594	D195 A196 E198 V221 W223 G226 C227
BS05	BGC	H	V531 R533 F549	V164 R166 F182

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:3p70, PDBe:3p70, PDBj:3p70
PDBsum	3p70
PubMed	21555742
UniProt	P00734\|THRB_HUMAN Prothrombin (Gene Name=F2)