Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6pwf Chain F

Receptor sequence >6pwfF (length=79) Species: 7227 (Drosophila melanogaster) [Search protein sequence] DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT EHAKRKTVTAMDVVYALKRQGRTLYGFGG

3D structure PDB 6pwf Structure of the primed state of the ATPase domain of chromatin remodeling factor ISWI bound to the nucleosome. Chain F Resolution 4.07 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 dna F R45 I46 R78 K79 T80 R22 I23 R55 K56 T57 BS02 dna F P32 R36 R45 P9 R13 R22

Gene Ontology Molecular Function GO:0003676 nucleic acid binding GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0046982 protein heterodimerization activity

	Biological Process
GO:0006334	nucleosome assembly

	Cellular Component
GO:0000228	nuclear chromosome
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0035059	RCAF complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component