Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5hz9 Chain E

Receptor sequence >5hz9E (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] SHMVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD ILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKW DGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

3D structure PDB 5hz9 Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors. Chain E Resolution 2.3 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 5M8 E T54 S56 A76 D77 T56 S58 A78 D79 MOAD: Ki=0.093uM BindingDB: Ki=93nM BS02 5M8 E V33 T57 V35 T59 MOAD: Ki=0.093uM BindingDB: Ki=93nM

Gene Ontology Molecular Function GO:0005515 protein binding GO:0008092 cytoskeletal protein binding GO:0008289 lipid binding GO:0036041 long-chain fatty acid binding GO:0070538 oleic acid binding

	Biological Process
GO:0008285	negative regulation of cell population proliferation
GO:0015909	long-chain fatty acid transport
GO:0032365	intracellular lipid transport
GO:0042632	cholesterol homeostasis
GO:0046320	regulation of fatty acid oxidation
GO:0050873	brown fat cell differentiation
GO:0055091	phospholipid homeostasis
GO:0071073	positive regulation of phospholipid biosynthetic process
GO:0140214	positive regulation of long-chain fatty acid import into cell
GO:2001245	regulation of phosphatidylcholine biosynthetic process

	Cellular Component
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070062	extracellular exosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component