Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1odb Chain E

Receptor sequence >1odbE (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKD KAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHK

3D structure PDB 1odb Structure of the Human S100A12-Copper Complex: Implications for Host-Parasite Defence Chain E Resolution 2.19 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 CU E H15 D25 H16 D26 BS02 CA E S18 K21 H23 T26 E31 S19 K22 H24 T27 E32 BS03 CA E D61 N63 D65 Q67 E72 D62 N64 D66 Q68 E73 BS04 CU E H85 H89 H86 H90

Gene Ontology Molecular Function GO:0005507 copper ion binding GO:0005509 calcium ion binding GO:0005515 protein binding GO:0008270 zinc ion binding GO:0042802 identical protein binding GO:0046872 metal ion binding GO:0048306 calcium-dependent protein binding GO:0050786 RAGE receptor binding

	Biological Process
GO:0002548	monocyte chemotaxis
GO:0006805	xenobiotic metabolic process
GO:0006954	inflammatory response
GO:0030593	neutrophil chemotaxis
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0043406	positive regulation of MAP kinase activity
GO:0043542	endothelial cell migration
GO:0045087	innate immune response
GO:0045576	mast cell activation
GO:0050729	positive regulation of inflammatory response
GO:0050832	defense response to fungus
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide

	Cellular Component
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0034774	secretory granule lumen

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component