Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6ef5 Chain D

Receptor sequence >6ef5D (length=232) Species: 9606 (Homo sapiens) [Search protein sequence] SHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAY KNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVL SLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQA YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE AIAELDTLSEESYKDSTLIMQLLRDNLTLWTS

3D structure PDB 6ef5 14-3-3 with peptide Chain D Resolution 2.44 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 peptide D K49 R56 R60 R127 L172 N173 V176 E180 N224 K51 R58 R62 R129 L174 N175 V178 E182 N226

Gene Ontology Molecular Function GO:0003723 RNA binding GO:0005515 protein binding GO:0019901 protein kinase binding GO:0019904 protein domain specific binding GO:0031625 ubiquitin protein ligase binding GO:0042802 identical protein binding GO:0044325 transmembrane transporter binding GO:0045296 cadherin binding GO:0050815 phosphoserine residue binding GO:0140297 DNA-binding transcription factor binding GO:0140311 protein sequestering activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001525	angiogenesis
GO:0003016	respiratory system process
GO:0006468	protein phosphorylation
GO:0006605	protein targeting
GO:0007165	signal transduction
GO:0008039	synaptic target recognition
GO:0008104	protein localization
GO:0030324	lung development
GO:0031647	regulation of protein stability
GO:0035148	tube formation
GO:0042149	cellular response to glucose starvation
GO:0043066	negative regulation of apoptotic process
GO:0043067	regulation of programmed cell death
GO:0045824	negative regulation of innate immune response
GO:0051683	establishment of Golgi localization
GO:0070371	ERK1 and ERK2 cascade
GO:0070372	regulation of ERK1 and ERK2 cascade
GO:0090128	regulation of synapse maturation
GO:0090168	Golgi reassembly
GO:1900181	negative regulation of protein localization to nucleus
GO:1904262	negative regulation of TORC1 signaling

	Cellular Component
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005925	focal adhesion
GO:0031982	vesicle
GO:0042470	melanosome
GO:0070062	extracellular exosome
GO:0072562	blood microparticle
GO:0098686	hippocampal mossy fiber to CA3 synapse
GO:0098978	glutamatergic synapse

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component