Structure of PDB 3swm Chain C |
>3swmC (length=135) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
LPPGFRFYPTDEELMVQYLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKA LFGEKEWYFFSPRDRPNRVAGSGYWKATGTDKIISTEGQRVGIKKALVFY IGKAPKGTKTNWIMHEYRLIEPSDDWVLCRIYKKQ |
|
PDB | 3swm DNA binding by the plant-specific NAC transcription factors in crystal and solution: a firm link to WRKY and GCM transcription factors. |
Chain | C |
Resolution | 4.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
C |
T98 G99 |
T78 G79 |
|
|
|
|