BioLiP

Structure of PDB 3ogx Chain C

Receptor sequence

>3ogxC (length=171) Species: 9838 (Camelus dromedarius) [Search protein sequence]

EDPPACGSIVPRREWRALASECRERLTRPVRYVVVSHTAGSHCDTPASCA
QQAQNVQSYHVRNLGWCDVGYNFLIGEDGLVYEGRGWNIKGAHAGPTWNP
ISIGISFMGNYMNRVPPPRALRAAQNLLACGVALGALRSNYEVKGHRDVQ
PTLSPGDRLYEIIQTWSHYRA

3D structure

PDB

3ogx Structural basis of heparin binding to camel peptidoglycan recognition protein-S

Chain

Resolution

2.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y71 T152
Catalytic site (residue number reindexed from 1)	Y71 T152
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SGN	C	E24 W66 K90 A92 G95 N99	E24 W66 K90 A92 G95 N99

Gene Ontology

	Molecular Function
GO:0008270	zinc ion binding
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity
GO:0016019	peptidoglycan immune receptor activity
GO:0042834	peptidoglycan binding

	Biological Process
GO:0001818	negative regulation of cytokine production
GO:0009253	peptidoglycan catabolic process
GO:0016045	detection of bacterium
GO:0042742	defense response to bacterium
GO:0045087	innate immune response
GO:0050830	defense response to Gram-positive bacterium

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:3ogx, PDBe:3ogx, PDBj:3ogx
PDBsum	3ogx
PubMed	22509483
UniProt	Q9GK12\|PGRP1_CAMDR Peptidoglycan recognition protein 1 (Gene Name=PGLYRP1)