BioLiP

Structure of PDB 2amt Chain C

Receptor sequence

>2amtC (length=156) Species: 562 (Escherichia coli) [Search protein sequence]

MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLG
AAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIA
QAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEA
VALLIK

3D structure

PDB

2amt Fluorescent Inhibitors for IspF, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.

Chain

Resolution

2.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GPP	C	F7 G138 F139 R142	F7 G138 F139 R142
BS02	ZN	C	D8 H10 H42	D8 H10 H42
BS03	1AA	C	A100 K104 M105 L106 A131 T132 T133	A100 K104 M105 L106 A131 T132 T133	MOAD: Kd=36uM
BS04	1AA	C	H10 A33 H34 S35 D56 I57 G58 D63	H10 A33 H34 S35 D56 I57 G58 D63	MOAD: Kd=36uM

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0008685	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity
GO:0016829	lyase activity
GO:0030145	manganese ion binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006744	ubiquinone biosynthetic process
GO:0008299	isoprenoid biosynthetic process
GO:0016114	terpenoid biosynthetic process
GO:0019288	isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:2amt, PDBe:2amt, PDBj:2amt
PDBsum	2amt
PubMed	16392111
UniProt	P62617\|ISPF_ECOLI 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Gene Name=ispF)