Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2gbt Chain B

Receptor sequence >2gbtB (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] TKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFG DNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIED SVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGI AQ

3D structure PDB 2gbt The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase Chain B Resolution 1.7 Å 3D structure Catalytic site residues are labeled in the structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Catalytic site (original residue number in PDB) H46 H48 H63 H71 H80 D83 H120 R143 Catalytic site (residue number reindexed from 1) H45 H47 H62 H70 H79 D82 H119 R142 Enzyme Commision number 1.15.1.1: superoxide dismutase.

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 CU1 B H46 H48 H120 H45 H47 H119 BS02 ZN B H63 H71 H80 D83 H62 H70 H79 D82

Gene Ontology Molecular Function GO:0004784 superoxide dismutase activity GO:0005507 copper ion binding GO:0005515 protein binding GO:0008270 zinc ion binding GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0030346 protein phosphatase 2B binding GO:0031267 small GTPase binding GO:0042802 identical protein binding GO:0042803 protein homodimerization activity GO:0046872 metal ion binding GO:0051087 protein-folding chaperone binding

	Biological Process
GO:0000302	response to reactive oxygen species
GO:0000303	response to superoxide
GO:0001541	ovarian follicle development
GO:0001819	positive regulation of cytokine production
GO:0001890	placenta development
GO:0001895	retina homeostasis
GO:0002262	myeloid cell homeostasis
GO:0006749	glutathione metabolic process
GO:0006801	superoxide metabolic process
GO:0006879	intracellular iron ion homeostasis
GO:0006915	apoptotic process
GO:0006979	response to oxidative stress
GO:0007283	spermatogenesis
GO:0007566	embryo implantation
GO:0007605	sensory perception of sound
GO:0007626	locomotory behavior
GO:0008089	anterograde axonal transport
GO:0008090	retrograde axonal transport
GO:0008217	regulation of blood pressure
GO:0008340	determination of adult lifespan
GO:0009408	response to heat
GO:0009410	response to xenobiotic stimulus
GO:0010467	gene expression
GO:0019226	transmission of nerve impulse
GO:0019228	neuronal action potential
GO:0019430	removal of superoxide radicals
GO:0032287	peripheral nervous system myelin maintenance
GO:0032930	positive regulation of superoxide anion generation
GO:0033081	regulation of T cell differentiation in thymus
GO:0035234	ectopic germ cell programmed cell death
GO:0040014	regulation of multicellular organism growth
GO:0042542	response to hydrogen peroxide
GO:0042554	superoxide anion generation
GO:0043065	positive regulation of apoptotic process
GO:0043066	negative regulation of apoptotic process
GO:0043087	regulation of GTPase activity
GO:0043410	positive regulation of MAPK cascade
GO:0043524	negative regulation of neuron apoptotic process
GO:0045471	response to ethanol
GO:0046620	regulation of organ growth
GO:0046716	muscle cell cellular homeostasis
GO:0048538	thymus development
GO:0048678	response to axon injury
GO:0050665	hydrogen peroxide biosynthetic process
GO:0050728	negative regulation of inflammatory response
GO:0050766	positive regulation of phagocytosis
GO:0051093	negative regulation of developmental process
GO:0051881	regulation of mitochondrial membrane potential
GO:0060047	heart contraction
GO:0060052	neurofilament cytoskeleton organization
GO:0060087	relaxation of vascular associated smooth muscle
GO:0060088	auditory receptor cell stereocilium organization
GO:0072593	reactive oxygen species metabolic process
GO:0099610	action potential initiation
GO:1902177	positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:2000242	negative regulation of reproductive process

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005758	mitochondrial intermembrane space
GO:0005759	mitochondrial matrix
GO:0005777	peroxisome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0031410	cytoplasmic vesicle
GO:0032839	dendrite cytoplasm
GO:0032991	protein-containing complex
GO:0043025	neuronal cell body
GO:0070062	extracellular exosome
GO:1904115	axon cytoplasm

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component