Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1fip Chain B

Receptor sequence >1fipB (length=73) Species: 562 (Escherichia coli) [Search protein sequence] PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQALLDMVMQYTRGNQT RAALMMGINRGTLRKKLKKYGMN

3D structure PDB 1fip The structure of Fis mutant Pro61Ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue. Chain B Resolution 1.9 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 peptide B A34 Y38 A9 Y13 BS02 peptide B P26 L27 P1 L2

Gene Ontology Molecular Function GO:0000976 transcription cis-regulatory region binding GO:0001046 core promoter sequence-specific DNA binding GO:0001216 DNA-binding transcription activator activity GO:0001217 DNA-binding transcription repressor activity GO:0003677 DNA binding GO:0003700 DNA-binding transcription factor activity GO:0005515 protein binding GO:0042803 protein homodimerization activity GO:0043565 sequence-specific DNA binding GO:0044374 sequence-specific DNA binding, bending

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0009314	response to radiation
GO:0032359	provirus excision
GO:0045892	negative regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription
GO:0045911	positive regulation of DNA recombination
GO:0051276	chromosome organization

	Cellular Component
GO:0000786	nucleosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0009295	nucleoid
GO:0031421	invertasome
GO:0032993	protein-DNA complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component