Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5b5m Chain AI

Receptor sequence >5b5mAI (length=60) Species: 1050 (Thermochromatium tepidum) [Search protein sequence] FTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNI PVSYQALGKK

3D structure PDB 5b5m Structural Basis for the Unusual Qy Red-Shift and Enhanced Thermostability of the LH1 Complex from Thermochromatium tepidum. Chain AI Resolution 3.3 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 CRT AI L33 H36 L32 H35 BS02 BCL AI H36 W46 H35 W45 BS03 CRT AI L21 I24 L20 I23 BS04 BCL AI Q28 G32 I35 H36 Q27 G31 I34 H35 BS05 CRT AI K10 I11 I14 K9 I10 I13

Gene Ontology Molecular Function GO:0005515 protein binding GO:0042314 bacteriochlorophyll binding GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity GO:0046872 metal ion binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0019866	organelle inner membrane
GO:0030076	light-harvesting complex
GO:0030077	plasma membrane light-harvesting complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component