Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 8pkj Chain A

Receptor sequence >8pkjA (length=94) Species: 10090 (Mus musculus) [Search protein sequence] RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAI GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE

3D structure PDB 8pkj Nucleosome-bound NR5A2 structure reveals pioneer factor mechanism by DNA minor groove anchor competition. Chain A Resolution 2.5 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 dna A R42 T45 R72 R83 F84 V117 T118 R3 T6 R33 R44 F45 V78 T79 BS02 dna A R40 Y41 G44 V46 L65 R69 R1 Y2 G5 V7 L26 R30

Gene Ontology Molecular Function GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding GO:0003677 DNA binding GO:0030527 structural constituent of chromatin GO:0031492 nucleosomal DNA binding GO:0046982 protein heterodimerization activity

	Biological Process
GO:0001556	oocyte maturation
GO:0001649	osteoblast differentiation
GO:0006334	nucleosome assembly
GO:0006997	nucleus organization
GO:0007283	spermatogenesis
GO:0007286	spermatid development
GO:0007338	single fertilization
GO:0007566	embryo implantation
GO:0008283	cell population proliferation
GO:0008584	male gonad development
GO:0030307	positive regulation of cell growth
GO:0031508	pericentric heterochromatin formation
GO:0031509	subtelomeric heterochromatin formation
GO:0035264	multicellular organism growth
GO:0042692	muscle cell differentiation
GO:0048477	oogenesis
GO:0090230	regulation of centromere complex assembly
GO:1902340	negative regulation of chromosome condensation

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000781	chromosome, telomeric region
GO:0000785	chromatin
GO:0000786	nucleosome
GO:0000939	inner kinetochore
GO:0001740	Barr body
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0032991	protein-containing complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component