Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6pj2 Chain A

Receptor sequence >6pj2A (length=197) [Search protein sequence] MASMKKKGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGE VQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDL VGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPI SYLKGSSGGPLLCPAGHAVGIFRAAVSTRGVAKAVAFIPVESLETTM

3D structure PDB 6pj2 Avoiding Drug Resistance by Substrate Envelope-Guided Design: Toward Potent and Robust HCV NS3/4A Protease Inhibitors. Chain A Resolution 2.1 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number 3.6.4.13: RNA helicase.

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 ZN A C1097 C1099 C1145 H1149 C115 C117 C163 H167 BS02 OM7 A Q1041 F1043 Y1056 H1057 V1078 D1081 L1135 K1136 G1137 S1139 F1154 R1155 A1156 A1157 V1158 S1159 Q59 F61 Y74 H75 V96 D99 L153 K154 G155 S157 F172 R173 A174 A175 V176 S177 MOAD: Ki=81nM

Gene Ontology Molecular Function GO:0008233 peptidase activity GO:0008236 serine-type peptidase activity GO:0046872 metal ion binding

	Biological Process
GO:0006508	proteolysis
GO:0019062	virion attachment to host cell
GO:0019087	transformation of host cell by virus
GO:0046718	symbiont entry into host cell

	Cellular Component
GO:0016020	membrane
GO:0033644	host cell membrane
GO:0044423	virion component

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component