Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4aza Chain A

Receptor sequence >4azaA (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALY NHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDL DRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAV THIGRVYKERLGLPPKIVIGYQSHADTATKSGKNRFVV

3D structure PDB 4aza Improved Eif4E Binding Peptides by Phage Display Guided Design: Plasticity of Interacting Surfaces Yield Collective Effects. Chain A Resolution 2.16 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 peptide A H37 P38 Q40 V69 W73 E132 G139 E140 D143 H11 P12 Q14 V43 W47 E106 G113 E114 D117 BS02 MGO A W56 M101 W102 E103 R157 K159 K162 W30 M75 W76 E77 R131 K133 K136

Gene Ontology Molecular Function GO:0000339 RNA cap binding GO:0000340 RNA 7-methylguanosine cap binding GO:0003723 RNA binding GO:0003743 translation initiation factor activity GO:0005515 protein binding GO:0019899 enzyme binding GO:0031370 eukaryotic initiation factor 4G binding GO:0098808 mRNA cap binding GO:0140297 DNA-binding transcription factor binding

	Biological Process
GO:0000082	G1/S transition of mitotic cell cycle
GO:0001662	behavioral fear response
GO:0006406	mRNA export from nucleus
GO:0006412	translation
GO:0006413	translational initiation
GO:0006417	regulation of translation
GO:0010507	negative regulation of autophagy
GO:0017148	negative regulation of translation
GO:0019827	stem cell population maintenance
GO:0030182	neuron differentiation
GO:0045665	negative regulation of neuron differentiation
GO:0045931	positive regulation of mitotic cell cycle
GO:0051028	mRNA transport
GO:0051168	nuclear export
GO:0071549	cellular response to dexamethasone stimulus
GO:0099578	regulation of translation at postsynapse, modulating synaptic transmission

	Cellular Component
GO:0000932	P-body
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0010494	cytoplasmic stress granule
GO:0016281	eukaryotic translation initiation factor 4F complex
GO:0016442	RISC complex
GO:0016604	nuclear body
GO:0016607	nuclear speck
GO:0033391	chromatoid body
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component