Structure of PDB 2heo Chain A

Receptor sequence

>2heoA (length=59) Species: 10090 (Mus musculus) [Search protein sequence]

DNLEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSP
SPKYWSIGG

3D structure

PDB

2heo Structure-based secondary structure-independent approach to design protein ligands: Application to the design of Kv1.2 potassium channel blockers.

Chain

Resolution

1.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K142 K143 N146 Q147 Y150 K164	K31 K32 N35 Q36 Y39 K53

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003726	double-stranded RNA adenosine deaminase activity

	Biological Process
GO:0060340	positive regulation of type I interferon-mediated signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2heo, PDBe:2heo, PDBj:2heo
PDBsum	2heo
PubMed	17165772
UniProt	Q9QY24\|ZBP1_MOUSE Z-DNA-binding protein 1 (Gene Name=Zbp1)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417