Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2bpn Chain A

Receptor sequence >2bpnA (length=107) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough) [Search protein sequence] APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAG CHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGC KKSKCHE

3D structure PDB 2bpn Solution Structures of Tetrahaem Ferricytochrome C(3) from Desulfovibrio Vulgaris (Hildenborough) and its K45Q Mutant: The Molecular Basis of Cooperativity. Chain A Resolution N/A 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 HEC A P5 L9 M11 F20 H22 V28 C30 C33 H34 Y43 P5 L9 M11 F20 H22 V28 C30 C33 H34 Y43 BS02 HEC A C33 H35 V37 D42 K45 C46 C51 H52 A62 H67 V68 T74 K75 F76 C33 H35 V37 D42 K45 C46 C51 H52 A62 H67 V68 T74 K75 F76 BS03 HEC A H25 C79 C82 H83 H25 C79 C82 H83 BS04 HEC A E12 A13 T14 Q16 V18 Y65 Y66 H70 C79 V80 H83 L97 T98 G99 C100 C105 H106 E12 A13 T14 Q16 V18 Y65 Y66 H70 C79 V80 H83 L97 T98 G99 C100 C105 H106

Gene Ontology Molecular Function GO:0009055 electron transfer activity GO:0020037 heme binding GO:0046872 metal ion binding

	Biological Process
GO:0009061	anaerobic respiration

	Cellular Component
GO:0042597	periplasmic space

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component