Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1g5n Chain A

Receptor sequence >1g5nA (length=318) Species: 10116 (Rattus norvegicus) [Search protein sequence] ALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQI AEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGA GTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRML VVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSV SHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAE TLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGD TSGDYKKALLLLCGGEDD

3D structure PDB 1g5n Annexin V--heparin oligosaccharide complex suggests heparan sulfate--mediated assembly on cell surfaces. Chain A Resolution 1.9 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 SGN A R23 K27 G28 R61 R22 K26 G27 R60 BS02 UAP A G28 L29 G27 L28 BS03 SGN A D162 T163 R206 D161 T162 R205 BS04 IDS A S202 R205 R206 S201 R204 R205 BS05 SGN A A2 L3 A1 L2 BS06 UAP A A2 L3 A1 L2 BS07 CA A M26 G28 G30 E70 M25 G27 G29 E69 BS08 CA A K68 L71 E76 K67 L70 E75 BS09 CA A T31 E33 T30 E32 BS10 CA A L98 K99 G100 A101 G102 D142 L97 K98 G99 A100 G101 D141 BS11 CA A T103 E105 T102 E104 BS12 CA A G181 K184 G186 E226 G180 K183 G185 E225 BS13 CA A D224 T227 E232 D223 T226 E231 BS14 CA A T187 E189 T186 E188 BS15 CA A M257 G259 G261 D301 M256 G258 G260 D300

Gene Ontology Molecular Function GO:0001786 phosphatidylserine binding GO:0005388 P-type calcium transporter activity GO:0005509 calcium ion binding GO:0005515 protein binding GO:0005543 phospholipid binding GO:0005544 calcium-dependent phospholipid binding GO:0017046 peptide hormone binding GO:0030971 receptor tyrosine kinase binding GO:0042802 identical protein binding

	Biological Process
GO:0007596	blood coagulation
GO:0030195	negative regulation of blood coagulation
GO:0043065	positive regulation of apoptotic process
GO:0050819	negative regulation of coagulation
GO:0051592	response to calcium ion
GO:0070588	calcium ion transmembrane transport
GO:0071284	cellular response to lead ion
GO:0097066	response to thyroid hormone
GO:0097211	cellular response to gonadotropin-releasing hormone
GO:1901317	regulation of flagellated sperm motility
GO:1902721	negative regulation of prolactin secretion

	Cellular Component
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0008021	synaptic vesicle
GO:0009897	external side of plasma membrane
GO:0012506	vesicle membrane
GO:0014704	intercalated disc
GO:0030018	Z disc
GO:0030425	dendrite
GO:0030672	synaptic vesicle membrane
GO:0042383	sarcolemma
GO:0042995	cell projection
GO:0043025	neuronal cell body
GO:0043204	perikaryon
GO:0043679	axon terminus
GO:0072563	endothelial microparticle

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component