Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5b5m Chain 7

Receptor sequence >5b5m7 (length=60) Species: 1050 (Thermochromatium tepidum) [Search protein sequence] FTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNI PVSYQALGKK

3D structure PDB 5b5m Structural Basis for the Unusual Qy Red-Shift and Enhanced Thermostability of the LH1 Complex from Thermochromatium tepidum. Chain 7 Resolution 3.3 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number ?

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 BCL 7 H36 W46 H35 W45 BS02 CRT 7 L21 I24 F27 L31 I38 L20 I23 F26 L30 I37 BS03 BCL 7 Q28 L31 G32 I35 H36 Q27 L30 G31 I34 H35

Gene Ontology Molecular Function GO:0005515 protein binding GO:0042314 bacteriochlorophyll binding GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity GO:0046872 metal ion binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0019866	organelle inner membrane
GO:0030076	light-harvesting complex
GO:0030077	plasma membrane light-harvesting complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component