BioLiP

Structure of PDB 1de9 Chain A Binding Site BS03

Receptor Information

>1de9 Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDIL
CLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKV
SYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAF
RKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGE
LLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLL
PALCDSKIRSKALGSDHCPITLYLAL

Ligand information

>1de9 Chain Z (length=9) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gatcggtag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1de9 DNA-bound structures and mutants reveal abasic DNA binding by APE1 and DNA repair coordination
Resolution	3.0 Å
Binding residue (original residue number in PDB)	G71 R73 A74 K98 E101 G127 M270 M271
Binding residue (residue number reindexed from 1)	G29 R31 A32 K56 E59 G85 M228 M229

Enzymatic activity

Catalytic site (original residue number in PDB)	D70 E96 N212 D283 D308
Catalytic site (residue number reindexed from 1)	D28 E54 N170 D241 D266
Enzyme Commision number	3.1.11.2: exodeoxyribonuclease III. 3.1.21.-

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0004518	nuclease activity
GO:0004519	endonuclease activity

	Biological Process
GO:0006281	DNA repair

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:1de9, PDBe:1de9, PDBj:1de9
PDBsum	1de9
PubMed	10667800
UniProt	P27695\|APEX1_HUMAN DNA repair nuclease/redox regulator APEX1 (Gene Name=APEX1)