Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6pwf Chain H Binding Site BS02

Receptor Information >6pwf Chain H (length=94) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRL AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

Ligand information >6pwf Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg gattactccctagtctccaggcacgtgtcagatatatacatccgat

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 6pwf Structure of the primed state of the ATPase domain of chromatin remodeling factor ISWI bound to the nucleosome. Resolution 4.07 Å Binding residue (original residue number in PDB) K29 Y39 I51 S52 S53 R83 T85 Binding residue (residue number reindexed from 1) K2 Y12 I24 S25 S26 R56 T58

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0044877 protein-containing complex binding GO:0046982 protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component