Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 3nh2 Chain F Binding Site BS02

Receptor Information >3nh2 Chain F (length=202) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTL HFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIK ASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLA LGQTVLSKACQTAGMDFDSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE EV

Ligand information >3nh2 Chain G (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] tacaac

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 3nh2 Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation Resolution 2.3 Å Binding residue (original residue number in PDB) H144 F146 Binding residue (residue number reindexed from 1) H136 F138

Enzymatic activity Enzyme Commision number 3.1.13.-

Gene Ontology Molecular Function GO:0000175 3'-5'-RNA exonuclease activity GO:0000287 magnesium ion binding GO:0003676 nucleic acid binding GO:0004527 exonuclease activity GO:0004540 RNA nuclease activity GO:0005515 protein binding GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity GO:0008408 3'-5' exonuclease activity GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters GO:0042802 identical protein binding GO:0042803 protein homodimerization activity GO:0046872 metal ion binding

	Biological Process
GO:0006259	DNA metabolic process
GO:0006396	RNA processing
GO:0006974	DNA damage response
GO:0008033	tRNA processing
GO:0031125	rRNA 3'-end processing
GO:0034644	cellular response to UV
GO:0042780	tRNA 3'-end processing
GO:0043628	regulatory ncRNA 3'-end processing
GO:0045004	DNA replication proofreading

	Cellular Component
GO:0005829	cytosol

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component