Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 4x0g Chain D Binding Site BS02

Receptor Information
>4x0g Chain D (length=108) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PMVTIGPNGTEVSRISLSAINWAMTGPSITRKLLCEIFDRDTLAHHTLSG
KPSPAFRDCARPSKQQLDPLKVADLVYLMTNSCDMTPREVRTAITTKCAD
ENKMLRSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x0g Common and distinct DNA-binding and regulatory activities of the BEN-solo transcription factor family.
Resolution3.2065 Å
Binding residue
(original residue number in PDB)		T49 L50 S51 K53 S55 F58 K66 R90 R93 T97 K105
Binding residue
(residue number reindexed from 1)		T47 L48 S49 K51 S53 F56 K64 R88 R91 T95 K103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003714 transcription corepressor activity
Biological Process
GO:0045666 positive regulation of neuron differentiation
GO:0045746 negative regulation of Notch signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4x0g, PDBe:4x0g, PDBj:4x0g
PDBsum4x0g
PubMed25561495
UniProtQ9VR17|ELBA1_DROME Early boundary activity protein 1 (Gene Name=Elba1)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417