BioLiP

Structure of PDB 3lon Chain C Binding Site BS02

Receptor Information

>3lon Chain C (length=151) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNV
DQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLS
PRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETT
M

Ligand information

>3lon Chain D (length=16) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GSVVIVGRIVLSGKPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3lon Candidate selection and preclinical evaluation culminating in the discovery of Narlaprevir (SCH 900518): A potent, selective and orally efficacious second generation HCV NS3 serine protease inhibitor
Resolution	2.2 Å
Binding residue (original residue number in PDB)	V29 G31 E32 V33 I35 V36 S37 R62 T63 I64 A65 P88 G90
Binding residue (residue number reindexed from 1)	V1 G3 E4 V5 I7 V8 S9 R34 T35 I36 A37 P60 G62

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D81 G137 S139
Catalytic site (residue number reindexed from 1)	H29 D53 G109 S111
Enzyme Commision number	3.4.21.98: hepacivirin. 3.6.1.15: nucleoside-triphosphate phosphatase. 3.6.4.13: RNA helicase.

Gene Ontology

	Molecular Function
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis
GO:0019087	transformation of host cell by virus

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:3lon, PDBe:3lon, PDBj:3lon
PDBsum	3lon
PubMed
UniProt	Q9ELS8