Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4kb0 Chain B Binding Site BS02

Receptor Information >4kb0 Chain B (length=204) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTT LHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGI KASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGL ALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGW PLSA

Ligand information >4kb0 Chain D (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] ggccctctttagggcccc

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 4kb0 Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways. Resolution 2.004 Å Binding residue (original residue number in PDB) E25 T26 F29 E73 A74 F77 H120 N121 F124 V163 L164 Binding residue (residue number reindexed from 1) E18 T19 F22 E66 A67 F70 H113 N114 F117 V156 L157

Enzymatic activity Enzyme Commision number 3.1.13.-

Gene Ontology Molecular Function GO:0000175 3'-5'-RNA exonuclease activity GO:0000287 magnesium ion binding GO:0003676 nucleic acid binding GO:0004527 exonuclease activity GO:0004540 RNA nuclease activity GO:0005515 protein binding GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity GO:0008408 3'-5' exonuclease activity GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters GO:0042802 identical protein binding GO:0042803 protein homodimerization activity GO:0046872 metal ion binding

	Biological Process
GO:0006259	DNA metabolic process
GO:0006396	RNA processing
GO:0006974	DNA damage response
GO:0008033	tRNA processing
GO:0031125	rRNA 3'-end processing
GO:0034644	cellular response to UV
GO:0042780	tRNA 3'-end processing
GO:0043628	regulatory ncRNA 3'-end processing
GO:0045004	DNA replication proofreading

	Cellular Component
GO:0005829	cytosol

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component