Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1p3o Chain B Binding Site BS02

Receptor Information >1p3o Chain B (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] VLRDNIQGITKPAIRRLARRGGAKRISGLIYEETRGVLKVFLENVIRDAV TYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Ligand information >1p3o Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag cagtttccaaatacacttttggtagaatctgcaggtggatattgat

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1p3o Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions Resolution 2.75 Å Binding residue (original residue number in PDB) V21 R35 R45 I46 S47 G48 R78 K79 T80 Binding residue (residue number reindexed from 1) V1 R15 R25 I26 S27 G28 R58 K59 T60

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0046982 protein heterodimerization activity

	Biological Process
GO:0006334	nucleosome assembly

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component