Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1bt6 Chain B Binding Site BS02

Receptor Information >1bt6 Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLA VDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK

Ligand information >1bt6 Chain D (length=11) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] STVHEILSKLS

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1bt6 The crystal structure of a complex of p11 with the annexin II N-terminal peptide. Resolution 2.4 Å Binding residue (original residue number in PDB) P1 E5 H6 E9 Binding residue (residue number reindexed from 1) P1 E5 H6 E9

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005509 calcium ion binding GO:0005515 protein binding GO:0008289 lipid binding GO:0042803 protein homodimerization activity GO:0044325 transmembrane transporter binding GO:0048306 calcium-dependent protein binding

	Biological Process
GO:0001765	membrane raft assembly
GO:0006900	vesicle budding from membrane
GO:0010756	positive regulation of plasminogen activation
GO:0042789	mRNA transcription by RNA polymerase II
GO:0043547	positive regulation of GTPase activity
GO:0045921	positive regulation of exocytosis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0050767	regulation of neurogenesis
GO:0051496	positive regulation of stress fiber assembly
GO:0051894	positive regulation of focal adhesion assembly
GO:0072659	protein localization to plasma membrane
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
GO:1905686	positive regulation of plasma membrane repair

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005886	plasma membrane
GO:0009986	cell surface
GO:0016363	nuclear matrix
GO:0045121	membrane raft
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:0090575	RNA polymerase II transcription regulator complex
GO:0098797	plasma membrane protein complex
GO:1990665	AnxA2-p11 complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component