Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 7peu Chain A Binding Site BS02

Receptor Information >7peu Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS SAVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGE

Ligand information >7peu Chain J (length=520) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] ggcactggaacaggatgtatatatgtgacacgtgcctggagactagggag taatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaa gcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggatt ctccaggggatgtggatgctcgggtccggcactggaacaggatgtatata tgtgacacgtgcctggagactagggagtaatccccttggcggttaaaacg cgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgac caattgagcggcctcggcaccgggattctccaggggatccggatgctcgg gtccggcacgtgaacaggatgtatatatgtgacacgtgcctggagactag ggagtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgt ttaagcggtgctagagctgtctacgaccaattgagcggcctcggcaccgg gattctccaggggatccgga

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 7peu Histone H1 binding to nucleosome arrays depends on linker DNA length and trajectory. Resolution 7.2 Å Binding residue (original residue number in PDB) R40 Y41 P43 G44 V46 R49 R53 K56 R63 K64 L65 P66 R83 Binding residue (residue number reindexed from 1) R4 Y5 P7 G8 V10 R13 R17 K20 R27 K28 L29 P30 R47

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0046982 protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006334	nucleosome assembly

	Cellular Component
GO:0000786	nucleosome
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0070062	extracellular exosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component