Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6bz3 Chain A Binding Site BS02

Receptor Information >6bz3 Chain A (length=125) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] DKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDET IPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQML TAAHALAVDAKNLLDVIDQARLKML

Ligand information >6bz3 Chain D (length=19) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] DDLSEQMASLEGLMKQLNA

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 6bz3 The binding of DCC-P3 motif and FAK-FAT domain mediates the initial step of netrin-1/DCC signaling for axon attraction. Resolution 2.497 Å Binding residue (original residue number in PDB) Y925 T929 K933 I936 S939 Q943 P946 Binding residue (residue number reindexed from 1) Y4 T8 K12 I15 S18 Q22 P25

Enzymatic activity Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.

Gene Ontology Molecular Function GO:0004713 protein tyrosine kinase activity

	Biological Process
GO:0006468	protein phosphorylation
GO:0007172	signal complex assembly

	Cellular Component
GO:0005925	focal adhesion

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component