Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2nqb Chain A Binding Site BS02

Receptor Information >2nqb Chain A (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Ligand information >2nqb Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag cagtttccaaatacacttttggtagaatctgcaggtggatattgat

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 2nqb Comparative analysis of nucleosome structures from different species. Resolution 2.3 Å Binding residue (original residue number in PDB) R440 Y441 P443 G444 V446 R449 R463 K464 L465 P466 R469 R483 Binding residue (residue number reindexed from 1) R3 Y4 P6 G7 V9 R12 R26 K27 L28 P29 R32 R46

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0031492 nucleosomal DNA binding GO:0046982 protein heterodimerization activity

	Biological Process
GO:0006334	nucleosome assembly

	Cellular Component
GO:0000785	chromatin
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005700	polytene chromosome
GO:0035059	RCAF complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component