Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2mtz Chain A Binding Site BS02

Receptor Information >2mtz Chain A (length=169) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] GRKLLTYQVKQGDTLNSIAADFRISTAALLQANPSLQAGLTAGQSIVIPG LPDPYTIPYHIAVSIGAKTLTLSLNNRVMKTYPIAVGKILTQTPTGEFYI INRQRNPGGPFGAYWLSLSKQHYGIHGTNNPASIGKAVSKGCIRMHNKDV IELASIVPNGTRVTINRGS

Ligand information >2mtz Chain G (length=4) Species: 1423 (Bacillus subtilis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] AEKA

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 2mtz Atomic model of a cell-wall cross-linking enzyme in complex with an intact bacterial peptidoglycan. Resolution N/A Binding residue (original residue number in PDB) R23 Q104 Binding residue (residue number reindexed from 1) R23 Q104

Enzymatic activity Enzyme Commision number 2.-.-.-

Gene Ontology Molecular Function GO:0016740 transferase activity GO:0016757 glycosyltransferase activity GO:0016787 hydrolase activity GO:0071972 peptidoglycan L,D-transpeptidase activity

	Biological Process
GO:0008360	regulation of cell shape
GO:0009252	peptidoglycan biosynthetic process
GO:0018104	peptidoglycan-protein cross-linking
GO:0030435	sporulation resulting in formation of a cellular spore
GO:0071555	cell wall organization

	Cellular Component
GO:0031160	spore wall

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component