BioLiP

Structure of PDB 1vrr Chain A Binding Site BS02

Receptor Information

>1vrr Chain A (length=203) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRIVEVYSHLNGLEYIQVHLPHIWEEIQEIIVSIDAEACRTKESKEKTKQ
GQILYSPVALNEAFKEKLEAKGWKESRTNYYVTADPKLIRETLSLEPEEQ
KKVIEAAGKEALKSYNQTDFVKDRVAIEVQFGKYSFVAYDLFVKHMAFYV
SDKIDVGVEILPMKELSKEMSSGISYYEGELYNVIRQGRGVPAVPLVLIG
IAP

Ligand information

>1vrr Chain D (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttatagatctataa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1vrr Implications for Switching Restriction Enzyme Specificities from the Structure of BstYI Bound to a BglII DNA Sequence.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	K42 K45 E46 P57 N61 S114 Y115 N116 K133 Y139 S172
Binding residue (residue number reindexed from 1)	K42 K45 E46 P57 N61 S114 Y115 N116 K133 Y139 S172

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003677	DNA binding
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0042802	identical protein binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:1vrr, PDBe:1vrr, PDBj:1vrr
PDBsum	1vrr
PubMed	15893669
UniProt	Q84AF2