Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 112m Chain A Binding Site BS02

Receptor Information >112m Chain A (length=154) Species: 9755 (Physeter catodon) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHL KTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKI PIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKEL GYQG

Ligand information Ligand ID NPN InChI InChI=1S/C4H7N/c1-3-4-5-2/h3-4H2,1H3 InChIKey FFDKYFGBIQQMSR-UHFFFAOYSA-N SMILES Software SMILES isocyanide CACTVS 3.341 OpenEye OEToolkits 1.5.0 CCC[N+]#[C-] Formula C4 H7 N Name N-PROPYL ISOCYANIDE ChEMBL DrugBank DB04050 ZINC PDB chain 112m Chain A Residue 156 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 112m Correlations between Bound N-Alkyl Isocyanide Orientations and Pathways for Ligand Binding in Recombinant Myoglobins Resolution 2.34 Å Binding residue (original residue number in PDB) L29 F43 H64 V68 Binding residue (residue number reindexed from 1) L30 F44 H65 V69 Annotation score 1

Enzymatic activity Enzyme Commision number 1.11.1.- 1.7.-.-

Gene Ontology Molecular Function GO:0004601 peroxidase activity GO:0005344 oxygen carrier activity GO:0016491 oxidoreductase activity GO:0019825 oxygen binding GO:0020037 heme binding GO:0046872 metal ion binding GO:0098809 nitrite reductase activity

	Biological Process
GO:0015671	oxygen transport
GO:0019430	removal of superoxide radicals

	Cellular Component
GO:0005737	cytoplasm
GO:0016528	sarcoplasm
GO:0070062	extracellular exosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component