Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 8w4p Chain 3 Binding Site BS02

Receptor Information >8w4p Chain 3 (length=163) Species: 29205 (Stephanocyclus meneghinianus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] ENEIGALAPTGFFDPAKLSDGISQEKFDQYRLAELKHGRAAMLAVLGYVA PETYRFGYDLIPGELSTRDIPNGVAALNAIPFGGWVQMIAFVGTVEAYGW FTSPTGVLDLPADILAKRQTSELQHGRLAMLAFLELIRHDSQNLAQPGFD GYDNLITGLPFLY

Ligand information Ligand ID DD6 InChI InChI=1S/C40H54O3/c1-29(17-13-19-31(3)21-22-36-33(5)25-34(41)26-37(36,6)7)15-11-12-16-30(2)18-14-20-32(4)23-24-40-38(8,9)27-35(42)28-39(40,10)43-40/h11-20,23-24,34-35,41-42H,25-28H2,1-10H3/b12-11+,17-13+,18-14+,24-23-,29-15+,30-16+,31-19+,32-20+/t34-,35+,39-,40+/m1/s1 InChIKey OGHZCSINIMWCSB-WMTIXGNLSA-N SMILES Software SMILES ACDLabs 12.01 CC([C@H]=C[C@H]=C(C#CC=1C(C)(C)CC(CC=1C)O)C)=[C@H]C=[C@H]\C=C(/C)\C=C\C=C(/C)\C=C/C32OC2(CC(CC3(C)C)O)C OpenEye OEToolkits 2.0.6 CC1=C(C(CC(C1)O)(C)C)C#CC(=CC=CC(=CC=CC=C(C)C=CC=C(C)C=CC23C(CC(CC2(O3)C)O)(C)C)C)C CACTVS 3.385 CC1=C(C#CC(\C)=C\C=C\C(C)=C\C=C\C=C(C)\C=C\C=C(C)\C=C/[C@@]23O[C@]2(C)C[C@@H](O)CC3(C)C)C(C)(C)C[C@H](O)C1 OpenEye OEToolkits 2.0.6 CC1=C(C(C[C@@H](C1)O)(C)C)C#C/C(=C/C=C/C(=C/C=C/C=C(\C)/C=C/C=C(\C)/C=C\[C@]23[C@](O2)(C[C@H](CC3(C)C)O)C)/C)/C CACTVS 3.385 CC1=C(C#CC(C)=CC=CC(C)=CC=CC=C(C)C=CC=C(C)C=C[C]23O[C]2(C)C[CH](O)CC3(C)C)C(C)(C)C[CH](O)C1 Formula C40 H54 O3 Name (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol; Diadinoxanthin ChEMBL DrugBank ZINC PDB chain 8w4p Chain 3 Residue 303 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 8w4p Structural insights into photosystem II supercomplex and trimeric FCP antennae of a centric diatom Cyclotella meneghiniana. Resolution 3.48 Å Binding residue (original residue number in PDB) D46 P47 L50 A76 Y80 G105 M162 F165 Binding residue (residue number reindexed from 1) D14 P15 L18 A44 Y48 G73 M130 F133 Annotation score 1

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0016168 chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009536	plastid
GO:0016020	membrane
GO:0030076	light-harvesting complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component