Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5kkz Chain Q Binding Site BS01

Receptor Information >5kkz Chain Q (length=179) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVE PGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAE ATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDS AGRIRKGPAPENLPIPLAKFIDETTIQLG

Ligand information Ligand ID ASC InChI InChI=1S/C6H8O6/c7-1-2(8)5-3(9)4(10)6(11)12-5/h2,5,7-10H,1H2/t2-,5+/m0/s1 InChIKey CIWBSHSKHKDKBQ-JLAZNSOCSA-N SMILES Software SMILES CACTVS 3.341 OC[CH](O)[CH]1OC(=O)C(=C1O)O OpenEye OEToolkits 1.5.0 C(C(C1C(=C(C(=O)O1)O)O)O)O OpenEye OEToolkits 1.5.0 C([C@@H]([C@@H]1C(=C(C(=O)O1)O)O)O)O CACTVS 3.341 OC[C@H](O)[C@H]1OC(=O)C(=C1O)O ACDLabs 10.04 O=C1OC(C(O)=C1O)C(O)CO Formula C6 H8 O6 Name ASCORBIC ACID; Vitamin C ChEMBL CHEMBL196 DrugBank DB00126 ZINC ZINC000100006770 PDB chain 5kkz Chain K Residue 1004 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 5kkz Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III. Resolution 2.97 Å Binding residue (original residue number in PDB) C151 H152 Binding residue (residue number reindexed from 1) C143 H144 Annotation score 1

Enzymatic activity Catalytic site (original residue number in PDB) H152 Catalytic site (residue number reindexed from 1) H144 Enzyme Commision number 7.1.1.8: quinol--cytochrome-c reductase.

Gene Ontology Molecular Function GO:0008121 ubiquinol-cytochrome-c reductase activity GO:0016491 oxidoreductase activity GO:0046872 metal ion binding GO:0051537 2 iron, 2 sulfur cluster binding

	Biological Process
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component