Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1f66 Chain G Binding Site BS01

Receptor Information >1f66 Chain G (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHK SLIGKKG

Ligand information >1f66 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag cagtttccaaatacacttttggtagaatctgcaggtggatattgat

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1f66 Crystal structure of a nucleosome core particle containing the variant histone H2A.Z. Resolution 2.6 Å Binding residue (original residue number in PDB) R1031 K1037 R1045 A1048 V1078 K1079 R1080 Binding residue (residue number reindexed from 1) R16 K22 R30 A33 V63 K64 R65

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding GO:0003677 DNA binding GO:0005515 protein binding GO:0030527 structural constituent of chromatin GO:0031490 chromatin DNA binding GO:0031492 nucleosomal DNA binding GO:0046982 protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0031507	heterochromatin formation
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0071392	cellular response to estradiol stimulus

	Cellular Component
GO:0000786	nucleosome
GO:0000791	euchromatin
GO:0000792	heterochromatin
GO:0001740	Barr body
GO:0005634	nucleus
GO:0005694	chromosome
GO:0070062	extracellular exosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component