BioLiP

Structure of PDB 6b9l Chain D Binding Site BS01

Receptor Information

>6b9l Chain D (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGD
QDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAES
DLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRK
GFYLAFQDIGACVALLSVRVYYKK

Ligand information

>6b9l Chain H (length=10) Species: 32644 (unidentified) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SAYPDSVPFR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6b9l Structure-Based Design of Novel EphA2 Agonistic Agents with Nanomolar Affinity in Vitro and in Cell.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	L54 M55 Q56 N57 Y65 M66 R103 F108 F156 R159 V161 C188 L192
Binding residue (residue number reindexed from 1)	L28 M29 Q30 N31 Y39 M40 R77 F82 F130 R133 V135 C162 L166

Enzymatic activity

Enzyme Commision number

2.7.10.1: receptor protein-tyrosine kinase.

External links

PDB	RCSB:6b9l, PDBe:6b9l, PDBj:6b9l
PDBsum	6b9l
PubMed	30110533
UniProt	P29317\|EPHA2_HUMAN Ephrin type-A receptor 2 (Gene Name=EPHA2)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417