Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 8z90 Chain C Binding Site BS01

Receptor Information
>8z90 Chain C (length=245) Species: 126796 (Thogoto virus (isolate SiAr 126)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECTLRALVEEYNGACKEAPKEMSKQFTDYNTFKRYTTSKKDHAPQMRLVY
SVRKPWPISMTPSKEIPLVFNGTKLKDTILDLGESKRTRANIVVPDYWSK
YGSQTSLEVVNAILYAEDLKVQRFFSTEWGEIRYGRMLPFRKPVQACPTI
EEVNPASIPHTLLQVFCPQYTTLDSKRKAHMGAVEKLKRVMEPICKVQTQ
ESAVHIARSLIDSNKKWLPTVVDHTPRTAEMAHFLCSKYHYVHTN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z90 Cryo-EM structures of Thogoto virus polymerase reveal unique RNA transcription and replication mechanisms among orthomyxoviruses
Resolution2.87 Å
Binding residue
(original residue number in PDB)		T46 S47 K48 H51 R56 Y59
Binding residue
(residue number reindexed from 1)		T37 S38 K39 H42 R47 Y50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006370 7-methylguanosine mRNA capping
GO:0075526 cap snatching
Cellular Component
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8z90, PDBe:8z90, PDBj:8z90
PDBsum8z90
PubMed38816392
UniProtQ9YNA4|PB2_THOGV Polymerase basic protein 2 (Gene Name=Segment)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417