BioLiP

Structure of PDB 1nb5 Chain C Binding Site BS01

Receptor Information

>1nb5 Chain C (length=220) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLA
EQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCK
FQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKG
IYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLI
ERGKNMCGLAACASYPIPLV

Ligand information

>1nb5 Chain S (length=8) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EPQNCSAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nb5 Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
Resolution	2.4 Å
Binding residue (original residue number in PDB)	N59 H61 S69 Q70 N112 V157 C205 S207
Binding residue (residue number reindexed from 1)	N62 H64 S72 Q73 N115 V164 C212 S214

Enzymatic activity

Catalytic site (original residue number in PDB)	Q19 C25 T31 H159
Catalytic site (residue number reindexed from 1)	Q20 C26 T32 H166
Enzyme Commision number	3.4.22.16: cathepsin H.

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:1nb5, PDBe:1nb5, PDBj:1nb5
PDBsum	1nb5
PubMed	12581647
UniProt	O46427\|CATH_PIG Pro-cathepsin H (Gene Name=CTSH)