Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 7n8n Chain B Binding Site BS01

Receptor Information >7n8n Chain B (length=202) Species: 1560514 (Melbournevirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] RKRDKSVNFRLGLRNMLAQIHPDISVQTEALSELSNIAVFLGKKISHGAV TLLPEGTKTIKSSAVLLAAGDLYGKDLGRHAVGEMTKAVTRYGSAKESKE GSRSSKAKLQISVARSERLLREHGGCSRVSEGAAVALAAAIEYFMGEVLE LAGNAARDSKKVRISVKHITLAIQNDAALFAVVGKGVFSGAGVSLISVPI PR

Ligand information >7n8n Chain I (length=125) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] tccggtgccgaggccgctcaattggtcgtagacagctctagcaccgctta aacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattactc cctagtctccaggcacgtgtcagat

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 7n8n Virus-encoded histone doublets are essential and form nucleosome-like structures. Resolution 3.89 Å Binding residue (original residue number in PDB) K31 R32 N37 S54 Q56 K87 T88 K128 G130 S131 R132 A143 R192 Binding residue (residue number reindexed from 1) K2 R3 N8 S25 Q27 K58 T59 K99 G101 S102 R103 A114 R163

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003677 DNA binding GO:0030527 structural constituent of chromatin GO:0046982 protein heterodimerization activity

	Biological Process
GO:0030261	chromosome condensation

	Cellular Component
GO:0000786	nucleosome
GO:0030430	host cell cytoplasm
GO:0042025	host cell nucleus
GO:0044423	virion component

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component