Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 2aqp Chain B Binding Site BS01

Receptor Information >2aqp Chain B (length=155) Species: 487 (Neisseria meningitidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSAGLHGFHIH ENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTV LHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMA CGVIK

Ligand information Ligand ID CU1 InChI InChI=1S/Cu/q+1 InChIKey VMQMZMRVKUZKQL-UHFFFAOYSA-N SMILES Software SMILES ACDLabs 10.04 CACTVS 3.341 OpenEye OEToolkits 1.5.0 [Cu+] Formula Cu Name COPPER (I) ION ChEMBL DrugBank ZINC PDB chain 2aqp Chain B Residue 200 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 2aqp CU/ZN superoxide dismutase from neisseria meningitidis E73A mutant Resolution 1.3 Å Binding residue (original residue number in PDB) H79 H81 H104 H160 Binding residue (residue number reindexed from 1) H48 H50 H73 H129 Annotation score 1

Enzymatic activity Enzyme Commision number 1.15.1.1: superoxide dismutase.

Gene Ontology Molecular Function GO:0004784 superoxide dismutase activity GO:0005507 copper ion binding GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0046872 metal ion binding

	Biological Process
GO:0006801	superoxide metabolic process
GO:0019430	removal of superoxide radicals
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0042597	periplasmic space

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component