BioLiP

Structure of PDB 1okv Chain B Binding Site BS01

Receptor Information

>1okv Chain B (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEE
YKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPE
VAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQP
ANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE
SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLL
NPPETLNL

Ligand information

>1okv Chain E (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRLIF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1okv Insights Into Cyclin Groove Recognition. Complex Crystal Structures and Inhibitor Design Through Ligand Exchange
Resolution	2.4 Å
Binding residue (original residue number in PDB)	M210 L214 W217 R250 L253 Q254 I281 T282 D283 T285
Binding residue (residue number reindexed from 1)	M36 L40 W43 R76 L79 Q80 I107 T108 D109 T111

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity

	Biological Process
GO:0044772	mitotic cell cycle phase transition

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:1okv, PDBe:1okv, PDBj:1okv
PDBsum	1okv
PubMed	14656438
UniProt	P20248\|CCNA2_HUMAN Cyclin-A2 (Gene Name=CCNA2)